PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 313aa    MW: 33850.2 Da    PI: 8.6562
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101010.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.2e-393293263
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                    +e+al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrn+PvGgg+rknkksss
  XP_011101010.1 32 REQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTAGGSLRNIPVGGGSRKNKKSSS 93
                    6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-292590IPR003851Zinc finger, Dof-type
PfamPF027019.9E-343490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1613690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MASVVKPMEE IVTANTTCPK SSLERKIGRP QREQALNCPR CNSTNTKFCY YNNYSLSQPR  60
YFCKTCRRYW TAGGSLRNIP VGGGSRKNKK SSSTSTTTSS SSFTAPSPSP ANYTSKKLPD  120
LIIPQHQNPK NSAHDTQDLD LGLISSTAND FKAINELIQV PNFEASKDLQ NPCSSSSSDH  180
HHHHHHLSAL ELLSGITRTG STRILNSFPV PIPNSTNHDP NAVNYSSSSS GFSSLTEFNK  240
PPLSFSIDGL GSSSNYGSFV HGVDQESSGK LLFPFQSLKQ VSNSTNDGGE SRDQHGDAGS  300
GYWPNGVIGG GSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101010.10.0PREDICTED: dof zinc finger protein DOF1.8-like isoform X2
TrEMBLA0A068UV021e-92A0A068UV02_COFCA; Uncharacterized protein
STRINGVIT_02s0025g02250.t013e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-40Dof family protein